Scaffold Ga0314867_000065

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0314867_000065

Scaffold Ga0314867_000065

Overview

Basic Information
Taxon OID	3300033808 Open in IMG/M
Scaffold ID	Ga0314867_000065 Open in IMG/M
Source Dataset Name	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	17208
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (81.82%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location Name	Peru: Loreto
Coordinates	Lat. (^o)	-6.3272	Long. (^o)	-74.8136	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001192	Metagenome / Metatranscriptome	752	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0314867_000065_10474_10689	F001192	AGGAGG	MGFLKTLFSTTGILIVVYILIGVFTNTASPHLPTTTGSLATLHSWVQYFISILFWPLSFWHPTFTLGKWTP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.