NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0373875_005205

Scaffold Ga0373875_005205


Overview

Basic Information
Taxon OID3300033817 Open in IMG/M
Scaffold IDGa0373875_005205 Open in IMG/M
Source Dataset NameLaboratory-enriched microbial communities from a contaminated site in Ontario, Canada - KB1_TCB MSP
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3048
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Persistent Organic Pollutants (Pop) → Unclassified → Unclassified → Anaerobic Enrichment Culture → Metagenomes From 1,2,4-Trichlorobenzene Dechlorinating Enrichment Cultures

Source Dataset Sampling Location
Location NameUniversity of Toronto, Ontario, Canada
CoordinatesLat. (o)43.65699737Long. (o)-79.3957Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021528Metagenome / Metatranscriptome218N
F069750Metagenome / Metatranscriptome123N

Sequences

Protein IDFamilyRBSSequence
Ga0373875_005205_1055_2293F021528GGAGMSSPSLGSLNEKEASEQELLNLFLFCGNSIIQRFKRVESFRVKQETKLLMYNKAVLLQELQHRELNMIDTLKLMLNDFEISSDSEVRVQPASYELGTGTKVEYPLFYTHEKGSQFGSKAYLNSDTWNFTLKPIAGGAGVGAFLQLSIPKNYYGNNFYSVGEQGTKATLSKVEGELKEKGVHASLSEADMSRVDTFKNIEPEEPFSSYYTLFSLLKARRAIQRGYGTTFLLSNTQQEFCVYDKLEEMRERSIDTTGYPSTMRFEHRLLNKAKVQSTYGFTKVADIFKGGYEVIREKQVESWKNSLFSFTAEELVLIGSKQLEQEMKRFKDEAPINWFSRFLKAYGAYYLASYAGKDVVIEALKNLEAERTMVWRAVKKFEVAERELLVLKQEEGSSKTLGTLYEELRRKVCLN
Ga0373875_005205_233_478F069750GAGGLIVGEYPLQENSFFVEGEKFLIRERKKEKGKKTKYYLCRLQPFRYVSSLFPTGEEESYTFDFEQKLYRLERREHSVTLKFV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.