NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334804_001447

Scaffold Ga0334804_001447


Overview

Basic Information
Taxon OID3300033818 Open in IMG/M
Scaffold IDGa0334804_001447 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13774
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3533Long. (o)19.0475Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029002Metagenome / Metatranscriptome189Y
F033454Metagenome / Metatranscriptome177Y

Sequences

Protein IDFamilyRBSSequence
Ga0334804_001447_12683_13231F029002GGCGGMQSHEVEKKHFADVLGALLGLLMIPMLLVGAAIVVPVVFAFRWIGKHREHSFRMLMKSRGRLMSWPELLRELRDTGGTCIEERFSSKGPVRFWWTRDDVYRDSPYEIIDWFTMRKGRGAEPFIHWCRARYTNADAGSAMLVDTGLVPRREIYALWSKCRSQSMTARWVEVAPPEILPPQPGQ
Ga0334804_001447_6393_6566F033454AGGMKSGNHPNSLLQRLLAKLKRLLSPKPEPEDPYAYRLAPLRRPPRDRSGAAVAEIDEE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.