NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326764_000699

Scaffold Ga0326764_000699


Overview

Basic Information
Taxon OID3300033830 Open in IMG/M
Scaffold IDGa0326764_000699 Open in IMG/M
Source Dataset NameHot spring sediment microbial communities from Norris Geyser Basin, Yellowstone National Park, WY, United States - NOR.RB_S
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9629
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (64.29%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Adnaviria → Zilligvirae → Taleaviricota → Tokiviricetes → Ligamenvirales → Lipothrixviridae → Alphalipothrixvirus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment → Hot Spring Microbial Communities From Different Geyser Basins In Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.7265Long. (o)-110.709Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056742Metagenome / Metatranscriptome137Y
F070317Metagenome / Metatranscriptome123Y
F077499Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0326764_000699_1424_1699F056742GGAGGMFINEVEKVYQVKVKSCEDFCKFYVLFLSVAEMLYGKHYNYAIFKAITRGRPNLYMCLKCNSTLTAEESVTHTLQHMKELGYKPLAYEENI
Ga0326764_000699_1772_2524F077499AGGMMGDLFIFPNESLKPVSYPNITNAEIIFVLTISIPIGGHPESDTPMEEKMKFLSTYTPLEFQKLYYMKTIDKALDILKHLLYTREDNVLFEIANKINSLYDVKELINKVKDVECAKDLKTLNITLTEAKRYIYPDISLSKYASAQAKQLGIKKYEYYAKLFQCYVETDKNLDMLTLFRVSNLVFNFLRINNLSHIIKKMQFKDENINRIAEKIKQRVKITLDAMTDRKPIEPDTNILNSITIRIKEIDLG
Ga0326764_000699_3369_3737F070317GAGMSAMEELKELNLERIVKDAQEGEVCVVNKILKGKLTDLMPLIKDPATLSQKAMEFIQNRGDDIFYLFQCTTRGGRNVKLLVRQSFDPRSTFYQLMKKYKTIKVGDEVNVFYNLEKRRYDFLL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.