NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308413_003414

Scaffold Ga0308413_003414


Overview

Basic Information
Taxon OID3300033886 Open in IMG/M
Scaffold IDGa0308413_003414 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090729_t10cd
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7621
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (88.89%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5341Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007404Metagenome / Metatranscriptome351Y
F012577Metagenome / Metatranscriptome279Y
F014738Metagenome / Metatranscriptome260Y

Sequences

Protein IDFamilyRBSSequence
Ga0308413_003414_3381_4829F012577AGGAGMLIAITKPHQQFPVPLTVADYEFSTSDDGDERGRVTLPPTFARSGVMTQIGDELIVYCTQLSKTIWRGQIERIEEARDGSITWHALGFGALQRDARISVVRNMTDMKRWKPIGEGIIASSGYDSRGDLWEYESVESSGNLVVQIRTKKEFTISNTTLFFLVYLFDQPQRYIPVENEDHIFVSQISYTGLADGVWVAPVNALVQTSTHQLILGVFTDLSTDGNLTSPGCFGWTIGVRASGVETVAGTTSVSFRAEINNLQFGTIDEEKLTIALNERGGCCTIHLPPAINASITKPDANLRDIIENADGTAVRYPRKRFLRDRPQPTIDFRTDSTLVWRFPETTRVIDISKAPNRIYGQYPGYWADYLTAMTTIRSLETRRQLAKRFASVGEYDTKAIADTRRDEAAVALDRQIAPLTVELDNSRYELMLRSGETVPNWAADVSDYAIVPGYYRNAKITARVVTRERTTYTVSFNPDDFVTALR
Ga0308413_003414_6204_6533F007404GGAGGMDIVEIFQLLAVGHAGLTALDYVWNAVFGAIGAATAYLADSEGEVILPHYDAEHYSVELGALGRVLVGAGAGVLVGYSGYVPFVAGVVAPTLLPILIDKVTAFAGRGRK
Ga0308413_003414_6530_6691F014738GAGGMKLDILLPVSAFVLAFVHPDAAQVAATAVLVLLMVRIERGRRARKKKSAQAVR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.