NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308413_005739

Scaffold Ga0308413_005739


Overview

Basic Information
Taxon OID3300033886 Open in IMG/M
Scaffold IDGa0308413_005739 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090729_t10cd
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5553
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (80.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5341Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004307Metagenome / Metatranscriptome444Y
F005028Metagenome / Metatranscriptome414Y
F032180Metagenome / Metatranscriptome180Y
F044842Metagenome / Metatranscriptome153Y

Sequences

Protein IDFamilyRBSSequence
Ga0308413_005739_3137_3370F032180AGGAMWWKIEEIPHQELEDWTKAVGRFERAAKRDVAVRAAGAFVIYDLNGVLGYVAGREAPDGAYLVERWVRKKKGWTLYE
Ga0308413_005739_3354_3824F005028AGGAGMCDDDLRNDDLRAAMSFFAARLRGVDVTEAGLRRWTRHKLRNDTQAVAELMLTVGYRPTFIRYFLRYHIPALNESAAVGETYTDPDAATEAHLGLCWRLDEDVLTVYTDLHRAAKRLRQPYRDLAAVCLRWGYVHETVVQMLAKTLERKAKDVVED
Ga0308413_005739_391_657F044842AGGAGMEEIELWCGVRGNTFRSTQCVRFVGEFLAVVDVARADEWVERCVLYRTEDGRVALHQMRLSLLDDGIDIAEVYVLPAPDAGEGVREQR
Ga0308413_005739_4342_4815F004307AGGAGMFKELIHNGSRSERPELNGAYTAIFRGVSQRQRPTFETRNDPEPTLEDVFVFEFEVIDADFGEPIRVSKWVRKPARLSHPGKSGKVTNLYKTLAALYGVVQMSDAQLENAEEFVEKEAIGRQYQLTLETKPSGWVEIVHIAPVRARMRKTKEDEVPF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.