NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308413_050868

Scaffold Ga0308413_050868


Overview

Basic Information
Taxon OID3300033886 Open in IMG/M
Scaffold IDGa0308413_050868 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090729_t10cd
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1183
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5341Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002229Metagenome / Metatranscriptome580Y
F002795Metagenome / Metatranscriptome529Y
F008135Metagenome / Metatranscriptome338Y
F092113Metagenome / Metatranscriptome107N

Sequences

Protein IDFamilyRBSSequence
Ga0308413_050868_14_295F002795GGAGGMMATNSGLVLRGMVAAYREFVSRKDGRLFRIITVFGDLVVGEAVLCAVDGYDVFVDTPGYARGEMVELPARLQFLRDGSGRPVIRLYVDEGVR
Ga0308413_050868_279_500F008135AGGAGMNDPRTERLLVSAGASIARVLDARQRHAVALALEVCWYIVAALPPDDELTFGDMVRLLRWFATGFREADDGDE
Ga0308413_050868_519_869F002229N/AMEADMVTLLTLDGVEDVDYVPSDAEVRASLDDAGLYGMVLNGVTWMRLSSGAGWWTVICNRRVTATLAAVGWCWVADGLGARGYWSPALACVPAEVRALCGGCGGCVDDDDGGDEE
Ga0308413_050868_927_1181F092113N/ARRLTQYVYVTAGRFRRSGVDYAVYRWHEHPYADDVLVERYRFALRLSDWYGIYDTLYGAAAGDTLAILPAPAPAPALAPARRRG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.