NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326768_001746

Scaffold Ga0326768_001746


Overview

Basic Information
Taxon OID3300033893 Open in IMG/M
Scaffold IDGa0326768_001746 Open in IMG/M
Source Dataset NameHot spring sediment microbial communities from Norris-Mammoth Corridor, Yellowstone National Park, WY, United States - NMC.RSW_S
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8595
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (55.56%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment → Hot Spring Microbial Communities From Different Geyser Basins In Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.7535Long. (o)-110.7249Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F057399Metagenome / Metatranscriptome136N

Sequences

Protein IDFamilyRBSSequence
Ga0326768_001746_235_648F057399GAGMSRTFEPIATLEGYQYAYVDRDLAPNSYLYKVVQELPSGGRIESEAVEVVVHPAAETQVYVHGGSAPIGEAILVSWIRSAPEPLTFTLYDVAGRQVYTQQVFAAEGSQLIPSPNAAGVYLLEVAGRDVHRTYRVLWH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.