NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326769_000449

Scaffold Ga0326769_000449


Overview

Basic Information
Taxon OID3300033894 Open in IMG/M
Scaffold IDGa0326769_000449 Open in IMG/M
Source Dataset NameHot spring water microbial communities from Norris-Mammoth Corridor, Yellowstone National Park, WY, United States - NMC.RSW_P
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17391
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (41.18%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Spring Water → Hot Spring Microbial Communities From Different Geyser Basins In Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.7535Long. (o)-110.7249Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F068875Metagenome / Metatranscriptome124N
F081384Metagenome / Metatranscriptome114N

Sequences

Protein IDFamilyRBSSequence
Ga0326769_000449_6978_7568F081384AGGMLITPSDFGGDYRLFNANNLDPDTIQAIDQAQAELARDLFPVGHSFITGNLPSAPPNLGLRALGLHNLFVPWVFLRLDLGILGAGVKRTSDVPGRSRFASGAFFAIARQYKYFLGEWLPYERYIDAVASSPTLLAVPIVVSQIVAPGMEIEISGDKYSVVASTTGLLTISPALPSGVTNLRFRQLSLCVDKTWNYL
Ga0326769_000449_9637_10542F068875N/AMALQCRCGQPIEAFGVPSCYTKMAPIVKLIFTTRPNQLITDPATQLELSPTNISFPDIYRLITPRLDDVSSERPEAVTEEIGATTYYVRDAARTITATVGQLPTEWAQRVAELRCQAEVGVFLVDANGTIWGRKVDTQTGVAGAPLPVVPSSIDARFAFPSYSSVQKHTITFQLPFTLADYEIIPLWNNGDVLNYSAPQPVGFRVFQQSGNWVVFLFSKYHAPNGTIVVPIANVANPADIEIYDASGTTLVASANANLGGGKYALNTTLAAGTQYILDCTAITSPPSTQFDWPALRVPFR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.