Scaffold Ga0314861_0281463

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0314861_0281463

Scaffold Ga0314861_0281463

Overview

Basic Information
Taxon OID	3300033977 Open in IMG/M
Scaffold ID	Ga0314861_0281463 Open in IMG/M
Source Dataset Name	Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	755
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location Name	Peru: Loreto
Coordinates	Lat. (^o)	-4.0712	Long. (^o)	-73.2029	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039911	Metagenome / Metatranscriptome	162	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0314861_0281463_450_629	F039911	GAG	MKYTIAVLLIIVAAAAGHFGLRRLTHKDLGFTPVERYASKLAKTLLHTEATAAQEAGGD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.