NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334981_0000312

Scaffold Ga0334981_0000312


Overview

Basic Information
Taxon OID3300033980 Open in IMG/M
Scaffold IDGa0334981_0000312 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)40981
Total Scaffold Genes57 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)46 (80.70%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000368Metagenome / Metatranscriptome1223Y
F057318Metagenome / Metatranscriptome136Y
F067678Metagenome / Metatranscriptome125N

Sequences

Protein IDFamilyRBSSequence
Ga0334981_0000312_20544_21002F067678GGAGMPTNYQFDDEDDIDTSTDVVSQLRKVNRALEKRTKELEQELGGLKSQTRQRTVKDVLQAKGLNPKIAVFIPQDVDTSEEAITAWVDEYGDVFGVQPAQTNEAPTQKGPDLSAQHRMNNVVSTGSMPSIDEDMFAKVAGVKSKEDLDALLGLN
Ga0334981_0000312_33312_33497F000368AGGAGGMEQFKQLGLTWFRAAASAAIALYLAGETDLKTLAAAALAGFAGPLLKWLDPSATEYGRGS
Ga0334981_0000312_9794_10225F057318GAGGMALPKNQNFEVSATGGAGTNGQPARYAAGIDGAQDFYDLQTAAQMSGSNPAFSTVPSPSGQRPFRGDSAAKLVPLDAPTQRPEEDVRTGGSMATDTMYATDSMANSEDADRMRAALPYLSTLAELPQTSNNFRNYVRYLKSVL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.