NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334982_0067466

Scaffold Ga0334982_0067466


Overview

Basic Information
Taxon OID3300033981 Open in IMG/M
Scaffold IDGa0334982_0067466 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1941
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053078Metagenome141N
F078653Metagenome116N

Sequences

Protein IDFamilyRBSSequence
Ga0334982_0067466_1005_1544F053078AGGAGMAISTLLSWFSQHQDTVPTVMHRMHMMDDGGVPAWTGDFATYLNAAAHATFAESEERKVHDGTAAEQATLLQVTVNRYKYPMHAALHKIKRCRARAGEPKPYDIGLTLIATRGNQVWAQEHLMRTYPLMLHREIWIECLERTLALLQERYTETPRAIVRGKSDSQLNAEVNDAQASYKA
Ga0334982_0067466_623_1030F078653GAGGMPKHPTKPDRYDALEAYVETCLPVLQLSHWKITLIHDVAPEDRYADIEPNEQARTANLRVGNLFWAQKPDEQRLTIAHELVHLHLCRLDHAVDRLEPVLGSAAWTPWAGVFEDVYERTTDAVALVVAPHLPMPTL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.