NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0371488_0002613

Scaffold Ga0371488_0002613


Overview

Basic Information
Taxon OID3300033983 Open in IMG/M
Scaffold IDGa0371488_0002613 Open in IMG/M
Source Dataset NameLab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)19595
Total Scaffold Genes24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States

Source Dataset Sampling Location
Location NameUSA: McLean, Ithaca, New York
CoordinatesLat. (o)42.5488Long. (o)-76.2662Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000250Metagenome / Metatranscriptome1458Y
F010761Metagenome299Y

Sequences

Protein IDFamilyRBSSequence
Ga0371488_0002613_4996_5340F010761N/AVGTTWRRAIAIGLAFVVAIASTFIFAYRAGRRARQFHTANEPIREWMSVPFIAHTHHIPAAVLFKAIGVHPREPHDRRSVRHLAHDLNRPVPELITQLQRAIDAAAQPPGGQPR
Ga0371488_0002613_5470_6042F000250N/AMLRSRLRRRFHRNGSARAVPFHDARFDGFENGIPGRVTLKIYSATTIAGAALTTLLFAYSAFAHDHNFLNGTWTLVPARSDFAGQRVVQTGTVTINERQGIITVDRNFVYEGATETFFYRDMNDSDNSATIHTGKYLKTKTSWDHDVLKVKTTESGAVTLETFTLAADGTMLVNVARPDRKPITLIFQHQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.