NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0371488_0042060

Scaffold Ga0371488_0042060


Overview

Basic Information
Taxon OID3300033983 Open in IMG/M
Scaffold IDGa0371488_0042060 Open in IMG/M
Source Dataset NameLab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2933
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States

Source Dataset Sampling Location
Location NameUSA: McLean, Ithaca, New York
CoordinatesLat. (o)42.5488Long. (o)-76.2662Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002261Metagenome / Metatranscriptome577Y
F003186Metagenome / Metatranscriptome502N
F023143Metagenome / Metatranscriptome211Y

Sequences

Protein IDFamilyRBSSequence
Ga0371488_0042060_1466_1633F023143AGGAGMDWIFLESPTGEVREVEATAAALTPLLVAGWRQVPAPVATGPKSAASTQEDKQHG
Ga0371488_0042060_1646_2143F003186GAGVINPKTILGEWVTALQSCPDLVTAIGGGNVRAFMEGLATDNNLRLAILQMPPGSILVAWNGTTPRRLTGGSLHFAHRFSIYLRAPEQDSTATYADLFWLLVSAIPTGTPSWASLLHFQIDPDCYPMDMDLPSAQRNTVVVSADGATLDYFEVQATLVEQGNPGGE
Ga0371488_0042060_2151_2477F002261GGAMPNWPTIEAFVDGVMLQTFGEPVVYQPVQAGVAQGNPFTVTAIRHLRVRDESGAMANFEEISVNPSDFSNPPAKGDWVTAWGAQYVVTTVRQPDAYGMLNLALLQRAS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.