NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334989_0051606

Scaffold Ga0334989_0051606


Overview

Basic Information
Taxon OID3300033984 Open in IMG/M
Scaffold IDGa0334989_0051606 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2257
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021962Metagenome / Metatranscriptome216Y
F079622Metagenome / Metatranscriptome115Y

Sequences

Protein IDFamilyRBSSequence
Ga0334989_0051606_2074_2256F021962N/AVLAKTLPPQFTPRSKYYAIKTIWFREEIFKRDVQLLKIDTAEQLGDIFTKGLTRFVFEYL
Ga0334989_0051606_365_919F079622N/ALQVDFEKRKEGDVYNDCLMTIDGTDFRVAQTGAAITGNAFGSHKYSGKSALRYEIGVSILRGDLVWINGPYPAGAWTDIKIFNKVLRHFLEEGERVEADNGYVGATDKIKCPNNPCNPVANKGMQSCARYHHKMINGRFKTWQILKNTYRHDLSRHGEVFRAIAIITQIGIENGEPLFQVKYED

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.