NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334996_0002858

Scaffold Ga0334996_0002858


Overview

Basic Information
Taxon OID3300033994 Open in IMG/M
Scaffold IDGa0334996_0002858 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11842
Total Scaffold Genes31 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (16.13%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010397Metagenome / Metatranscriptome304Y
F019824Metagenome / Metatranscriptome227Y
F045085Metagenome / Metatranscriptome153Y
F091907Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0334996_0002858_103_288F010397AGGAGMNVNEFERLKPVVTMQKINELIKLIDEERVKTEILYRDRVRSLDDISILLKEAKKSFVKG
Ga0334996_0002858_2688_2966F091907N/AMNMNKNKTGRKATAVNEITDRNFTIVDLININSSVKAPTIRMHVKRSVASGRYKISGSQKTGKRGKPSIVYTYESIATATVSATETAVASSN
Ga0334996_0002858_3683_4015F019824N/AMDKYITDNFTGSIDDLLNHCSNLDVDKVEQQVKVEEKEACIQVIMKELECNEFEAEVIYNELVLSEVKETVDKMVEDGLLYVSGHNEDGEPLFQLTELGKAVRNELGDGK
Ga0334996_0002858_551_715F045085N/AMNILYKLINLTIGLIFGSIFAIGLLLILSIFFVVLIPFIFYFTVREVLKQLTKR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.