NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334996_0058107

Scaffold Ga0334996_0058107


Overview

Basic Information
Taxon OID3300033994 Open in IMG/M
Scaffold IDGa0334996_0058107 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2373
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012670Metagenome / Metatranscriptome278Y
F017628Metagenome / Metatranscriptome239Y
F103134Metagenome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0334996_0058107_1182_1655F012670GGAGMTEDEILFGPIRPAGTLVSDENKLAAAKAQTAQKRAMKLATGQREPKPFPKNPNMAGRQKSIVNRVTEYGSLFNKLNQERVEKGLSPLKTAMEVLIDAMQSDEIDLKDKAKIAEKLATFESSRAPIISIEHVQNISKDEEVSADDALEDFMAAIRKV
Ga0334996_0058107_2_451F017628GGAGMATYDIEALKQDLPTAKELAQFVYDRVNIALDLIGKPKDEQYQVAKRALEGKNVPADYITGENPYVDKKDLVPEDPMPPVPEREKDLPERDAQVHFFGATNMPHPLDPQSDRKVHISFRKYENGAITFEVVGPLEKQAVGSRINKYGQNV
Ga0334996_0058107_615_836F103134N/AMSYGKVISGGKQMSKGLTKGINDKLAGFEGENKRRAVVAGAVRKAFTQNPLSDNHTNNVNGGKFTTPKLPAKV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.