NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334979_0038944

Scaffold Ga0334979_0038944


Overview

Basic Information
Taxon OID3300033996 Open in IMG/M
Scaffold IDGa0334979_0038944 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3130
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (70.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001872Metagenome / Metatranscriptome623Y
F002794Metagenome / Metatranscriptome529Y
F010530Metagenome / Metatranscriptome302Y

Sequences

Protein IDFamilyRBSSequence
Ga0334979_0038944_1634_2074F001872GAGMNEWINQAIAASNGALWNNGSWGQRDMRGKPGSLSVHATGRAVDLSYRKSEKHPNAGRKEALVFIDKLVANANDLGLQCILDYMPKEHGRAWRCDRYAWQKYDKPTIHGAPGGDWFHIEITPQAADSVIWVKAAFLKVFGEIPPKA
Ga0334979_0038944_2802_3065F002794GGAGMSEGSAWNQGELTEETRRMVMEQAMNTNHAMAIFGLMDDILAVSQNPHASIIRRLRAMKNQLSLNDPMPLHDVTTLDQAIKALEAHS
Ga0334979_0038944_639_962F010530GGAGMIDYDLILSTNYATSLWVLVGNTYEGLDWLDTAPKPTQAELDAQWAQVDYSNQVLQVETTRRTQYEAQSDGLFFEWQRGTNTQAAWEAAVQAVKDANPYPPAPTKKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.