NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334986_0031955

Scaffold Ga0334986_0031955


Overview

Basic Information
Taxon OID3300034012 Open in IMG/M
Scaffold IDGa0334986_0031955 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3468
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001872Metagenome / Metatranscriptome623Y
F002421Metagenome / Metatranscriptome560N
F010535Metagenome / Metatranscriptome302Y

Sequences

Protein IDFamilyRBSSequence
Ga0334986_0031955_1548_2078F001872N/AVAVAKAKAGVPNARDYIGNADGASPAPRAGMNEFIKQVTAHSNGAFVNLGSWGQRDVKGKPGTLSVHATGRAWDAGFTTSEKHPNATRKNAKAFIDKMIAHANELGIQMVIDYFPKEFGAAWRCDRQAWKNYDSKTVSGAPGGRWFHIEISPQAADSVIWVKAAFLKVFGEIPPKA
Ga0334986_0031955_2119_2295F010535AGGAMTEPQIFDYSVYTGVMDNGQEILVQIFTSPESGKFLMGQIAFKTATSSWGQPIPLEKR
Ga0334986_0031955_3083_3466F002421GGAGMKTCTICKGSIAYPEITGKTHFVCDGRVPARKHAPFIQGMLASQSSADARWTRDEQNKVDAAIVHVARTKGFFTSDDIWQHLGDQFPVTKGIAGRLNAAARRGIIRNTGELAYAQRGGAHDHAQRLSV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.