NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334986_0034012

Scaffold Ga0334986_0034012


Overview

Basic Information
Taxon OID3300034012 Open in IMG/M
Scaffold IDGa0334986_0034012 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3347
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (37.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001120Metagenome / Metatranscriptome772Y
F001807Metagenome / Metatranscriptome631Y
F003601Metagenome / Metatranscriptome477Y

Sequences

Protein IDFamilyRBSSequence
Ga0334986_0034012_2475_2723F001807AGGMIVLLIEDTFIDGNDVTVTAVVDDMRLIHRSTYLDPEEYAPALCRASFELDEGEQIPLDEDGFCSYLTHLEPNWELLPVDND
Ga0334986_0034012_2978_3175F001120GAGGMTDKSPINFDKTIAGFNVTEHGIKSFTKSIKLGPFRVTLNARESGVRGSISLPGTGLSKRNIKLF
Ga0334986_0034012_392_616F003601AGGMTEYTDEQLLAQALANIGEYIHTNGTPDYVLIDDQDPRNEDDYDTWSYGTEPLPHDHTWQHASIDVDVSPSEPE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.