NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334998_0074535

Scaffold Ga0334998_0074535


Overview

Basic Information
Taxon OID3300034019 Open in IMG/M
Scaffold IDGa0334998_0074535 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2308
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041188Metagenome / Metatranscriptome160N
F073057Metagenome120N

Sequences

Protein IDFamilyRBSSequence
Ga0334998_0074535_1996_2307F041188N/ALKAYAKKNNIELFEANTKLEILEILASWIPPEKTEETVEEADKAKNLTNKIALYSDRNIHMDNLGSLKVGYNIVSKEASEKWLTHRLVRIAPPEEVASYYAKA
Ga0334998_0074535_1_507F073057N/AMNNIVNYSLGFLEGVNRGKKIFFDKLGVGTIQALAQYIDVQARANPKALHHVYEWNQTGSPSARLFNLGYTVSNLGLSVNSTFRQSRSVSENMTTPFYNKAKIMEEGIPVTITPTKSKVLKFNGPNGEVFTSKPIKVENPGGDSVVGGFESVFDEFMTRYFKQSFLKAS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.