NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335021_0003307

Scaffold Ga0335021_0003307


Overview

Basic Information
Taxon OID3300034023 Open in IMG/M
Scaffold IDGa0335021_0003307 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12354
Total Scaffold Genes28 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)20 (71.43%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000450Metagenome / Metatranscriptome1126Y
F018349Metagenome / Metatranscriptome235Y
F038643Metagenome / Metatranscriptome165Y
F063623Metagenome / Metatranscriptome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0335021_0003307_11814_12104F038643N/AMYNSNHNNNERKKMTDTTNWAKYPFTVDGVEFVSLLDPNGSMYQQVSRIPASLFTTMNEGAIREIVGKVSLMSKSEIQAELDRVNDGYSQAYLALA
Ga0335021_0003307_4515_4787F063623AGGAMYTTELPDNLQKLVDMNIPGTDILHGELKWLMKEAEEQLELAQEAENKTGEAMDSMDRKYWEGQLDALSHVYALTYQLAFAIDERTKARG
Ga0335021_0003307_6410_6814F000450AGGCGGMGDRANFVFVQPSGETIVLYGHWAGHGMLEKLGEAVAKAQPRWTDPSYATRIAISQMIGDGWGMETGWGLQVNEISDNEHKIPVINWIDQTMSLHEEDSFYNESNKVRGMKNDAIFTMDLRTFVEKYTDAKILV
Ga0335021_0003307_7018_7182F018349AGGAGGMDYKDGFEDGVKFTREVIIANIRKWAEDSILGEEGAIMDSIADKIEFGTLDNDL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.