NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334927_011663

Scaffold Ga0334927_011663


Overview

Basic Information
Taxon OID3300034024 Open in IMG/M
Scaffold IDGa0334927_011663 Open in IMG/M
Source Dataset NameBiocrust microbial communities from Mojave Desert, California, United States - 23HNC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2775
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.3778Long. (o)-117.6098Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001042Metagenome / Metatranscriptome794Y
F011201Metagenome / Metatranscriptome293Y

Sequences

Protein IDFamilyRBSSequence
Ga0334927_011663_1517_1894F001042GGAGMTFTGDCPEGRSQDLTCAEADAKIVIDKMLVNKLTELLITSIYSVHTSRRSEIFLTSLDMHLAQYSISNKNDTAHREFSEKSALLLESYQEDVPKSLGKAESCLGEAIDLINLIVSASEAGVNNE
Ga0334927_011663_99_449F011201N/AMKKSKAKSKMGHGGARPGAGRLPIWKHRPLKMVRLPLAFVEEILKVAQYMDQNDGRLPFSAASEDLVIILGHPSKSLSGEELKELAAREKARKLAERVMVGDEWVVVNDETFRNQH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.