Scaffold Ga0334940_001359

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0334940_001359

Scaffold Ga0334940_001359

Overview

Basic Information
Taxon OID	3300034025 Open in IMG/M
Scaffold ID	Ga0334940_001359 Open in IMG/M
Source Dataset Name	Biocrust microbial communities from Mojave Desert, California, United States - 36SMC
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7125
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	34.3778	Long. (^o)	-117.6098	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039537	Metagenome / Metatranscriptome	163	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0334940_001359_5679_6011	F039537	AGGGGG	MATSRKAQAKAGVPQRRRGQQMGDERSQPGKIDEAQQETPALRGRRKAANKFFADDSSQHTGTRGETPRDNTPSVPAAIPTKMKIGESGGESEFKARQKAARKTPSKGRG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.