NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334995_0018601

Scaffold Ga0334995_0018601


Overview

Basic Information
Taxon OID3300034062 Open in IMG/M
Scaffold IDGa0334995_0018601 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6250
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011077Metagenome / Metatranscriptome295Y
F020851Metagenome / Metatranscriptome221Y
F037701Metagenome / Metatranscriptome167Y

Sequences

Protein IDFamilyRBSSequence
Ga0334995_0018601_1075_1203F020851GAGMSEDIVDLAISMAEIDTGMQLPLEEREAMKQRIITRIANLNE
Ga0334995_0018601_744_902F011077GAGMITDNMTWAEEESGLWKGWTYSLEKNRYYFDDVGNESLAAFWADEFLNQAYE
Ga0334995_0018601_914_1060F037701AGGAMIKSKEWRVSNRVWLGVGFSPRRIALGFSVDRFNANIDFLCFWVSLEY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.