NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334995_0064993

Scaffold Ga0334995_0064993


Overview

Basic Information
Taxon OID3300034062 Open in IMG/M
Scaffold IDGa0334995_0064993 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2899
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003965Metagenome / Metatranscriptome459Y
F029439Metagenome / Metatranscriptome188Y
F093770Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0334995_0064993_1865_2074F093770GGAGMITLNHSINLVTEIDEHKMPDHLLNTFVNLSELQMEKLLRGAFIQALHDKKFLDEINAGNSWAVVKVAN
Ga0334995_0064993_565_744F003965AGGAMNSNVIIAVCKSHVPNKSAISDVNDTQFTFCEVCENNIERWYNDTDPERLPMWTNWQVS
Ga0334995_0064993_68_283F029439AGGMTTLNTITLEPSHAMASSNTGNPMVFRNTVGNYISRKAYLELLTTKQGVVSHRYLSPNESRWVMSNMKESN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.