Scaffold Ga0310130_0000336

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0310130_0000336

Scaffold Ga0310130_0000336

Overview

Basic Information
Taxon OID	3300034073 Open in IMG/M
Scaffold ID	Ga0310130_0000336 Open in IMG/M
Source Dataset Name	Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	38323
Total Scaffold Genes	48 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	33 (68.75%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location Name	USA: Oklahoma
Coordinates	Lat. (^o)	35.784	Long. (^o)	-98.26	Alt. (m)		Depth (m)	2896
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009680	Metagenome / Metatranscriptome	314	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0310130_0000336_21960_22265	F009680	GGAGG	MTEVWQYVATTSIGIILTMLGFWFTIGRNMATKSEVCDMIETKSPYVQDRQFIMERLAVNKETQAAFAAALQRNTEVMNELKLQIATLGHTLEALESRIER

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.