NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335020_0001033

Scaffold Ga0335020_0001033


Overview

Basic Information
Taxon OID3300034082 Open in IMG/M
Scaffold IDGa0335020_0001033 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)20162
Total Scaffold Genes29 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)25 (86.21%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002501Metagenome / Metatranscriptome553Y
F004006Metagenome / Metatranscriptome457Y
F018177Metagenome / Metatranscriptome236Y

Sequences

Protein IDFamilyRBSSequence
Ga0335020_0001033_15189_15404F004006AGGAMREDIEGLVTSINMNQVLVAILEEHGKLVVPTLRFLDVNVSNKELVIDYDETGPSFTFSLREKDGVESDSN
Ga0335020_0001033_16747_16935F018177GGAGMPNINEFLGKPEKLFSPELEKMGGIKPCNKCDKDSEEYFWDAVSNTISWECPDGHKNSYVVG
Ga0335020_0001033_7494_7679F002501AGGMWCGKCNGRVFVDRVFSQKLHMELFCIMCGKRWMCNKETSAFGKWLDKKETKNLKNYGIS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.