NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0373912_0190218

Scaffold Ga0373912_0190218


Overview

Basic Information
Taxon OID3300034088 Open in IMG/M
Scaffold IDGa0373912_0190218 Open in IMG/M
Source Dataset NameUranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B5A4.1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)563
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry → Uranium-Contaminated Sediments Microbial Communities After Treatment In Bioreactor, Oak Ridge, Tennessee, United States

Source Dataset Sampling Location
Location NameUSA: Oak Ridge, Tennessee
CoordinatesLat. (o)36.0103Long. (o)-84.2696Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024002Metagenome / Metatranscriptome208Y

Sequences

Protein IDFamilyRBSSequence
Ga0373912_0190218_107_463F024002N/AMAAVVALIPMAAQGSGSAYLDGAHDPQMIARQPMGFSISRAVLTENIRHLKATRCSHPLSGLRNRLGCFIEGTDDLGQVQPTDMQIDGGRGGRSVAKKHLDMVETCSCFNQVGGEAVP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.