NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0373913_0021290

Scaffold Ga0373913_0021290


Overview

Basic Information
Taxon OID3300034089 Open in IMG/M
Scaffold IDGa0373913_0021290 Open in IMG/M
Source Dataset NameUranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B5A4.2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1534
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry → Uranium-Contaminated Sediments Microbial Communities After Treatment In Bioreactor, Oak Ridge, Tennessee, United States

Source Dataset Sampling Location
Location NameUSA: Oak Ridge, Tennessee
CoordinatesLat. (o)36.0103Long. (o)-84.2696Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047999Metagenome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0373913_0021290_379_1080F047999AGGAGGMFTRTFCIACAVLFFAASAWAQVSPDGHWEGTITVNDREIGLSLDIAKNTKSGWIGSMGLPSEKMTGLVVTDITVNGQFVKFVAVELQMAKVELTLDAAGKMKGTISTPQGPVPVEFKRTGEANVALIPASPAVSKELEGDWEGSLQTPDRAFRIIVHFRNQPDNTVTATIDTPDTGGMGLPLNDVKQTGQNVEFGIKIAHANFQGTLNQEGIELTGQWGHQESRIPLTLRKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.