NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335027_0004220

Scaffold Ga0335027_0004220


Overview

Basic Information
Taxon OID3300034101 Open in IMG/M
Scaffold IDGa0335027_0004220 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12642
Total Scaffold Genes29 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)22 (75.86%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015591Metagenome / Metatranscriptome253N
F026250Metagenome / Metatranscriptome198Y
F048951Metagenome / Metatranscriptome147N

Sequences

Protein IDFamilyRBSSequence
Ga0335027_0004220_2453_2701F048951AGGAGGMKHKRVNKGYNYPASALLKEFPNDMWASTIGERLGVGRAAIQTWREGNTYLDQWRADKYACLLGKHPSEIWSNWFDEVELAS
Ga0335027_0004220_2741_2992F015591GGAGMTLTSEYEDPIAEFIEASAEGLCTGYVVIANIERINGDQSFWVTTLRNQTASTSLGLLESASAAEKYRIARSFNNRYDEDEDE
Ga0335027_0004220_7202_7498F026250N/AMNDPKEGIMTNRQKQIGTVIGMGILWGFWLMPTAEDLPDAQPATPLEWKLFIALNFAAIIYLHILNVREHQHQIRKEAQQRYWERMETRSRNNHPTAK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.