NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335029_0045311

Scaffold Ga0335029_0045311


Overview

Basic Information
Taxon OID3300034102 Open in IMG/M
Scaffold IDGa0335029_0045311 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3249
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (63.64%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007029Metagenome / Metatranscriptome359Y
F023592Metagenome / Metatranscriptome209Y
F029049Metagenome / Metatranscriptome189Y

Sequences

Protein IDFamilyRBSSequence
Ga0335029_0045311_1187_1693F029049N/AVSGVAKVILDRSQEVAAHRVGLERTIVRNANTSDASNFGQVYKNWHELVWQEAEGASAETAVANYFGDYAFVPKIHNAHEEADVGENIEVKWTKHANGHLILQNRGPGRPNDVAILVTGWSPVYILLGWMPVHMAKVPKYKHPYQDNYWVPRSNLFEMQYLKRSQYGV
Ga0335029_0045311_1869_2483F007029GAGMGFLDNYEDVNARIKRFRSEYPAGRLVAYIEDIDLIKGTILVKAEAYREYEDNVPSAVDYAFGNVSTYPNNMKKWFIEDTITSAYGRVIGLLTPSLEHNSRPTVQDMQKVETLPADSDPWSTKASIEDMSTMATAILEIGTQLGGELVAEAPRCPHGTMIWAEGTAKSTGKPWAAYKCTEKVRANQCQPYWHVLGSDGKWKPQV
Ga0335029_0045311_2483_2641F023592AGGMNSLDILVGLGACALGFLFMVLGYSIGYREGHGEGFVRGRAIAKALKESELI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.