NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335036_0008724

Scaffold Ga0335036_0008724


Overview

Basic Information
Taxon OID3300034106 Open in IMG/M
Scaffold IDGa0335036_0008724 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8381
Total Scaffold Genes24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)20 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033407Metagenome / Metatranscriptome177N
F077243Metagenome / Metatranscriptome117N
F097190Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0335036_0008724_1877_2065F077243GAGGMNLHEAAAMSAAQDIIEQAQSTSALEQRALTIVNLSVELHRKAIDLRLQAEEILKEIRYGLK
Ga0335036_0008724_2062_2379F097190GAGGMTDEQKKILTYLKKRKTPADLKSVRLQTKIDKQTTVNCLNALLKKGCIKTSFRIDPFTKERVWEWVKDEYEVKKVLRPKKKFKPVLSKQEEGVSFFNNPFNLRVA
Ga0335036_0008724_7293_7646F033407N/AMNLNTFEEGLLDSIQTERCKKLLWSVIQLAVDDACKAPYKTRPTDETITALRFLFGDLHESGLDNYLMWLDVDSKEFKRRMVNAMYAERHDKFTDFERRAFRANYNWYLRNEINPND

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.