Basic Information | |
---|---|
Taxon OID | 3300034135 Open in IMG/M |
Scaffold ID | Ga0334929_046963 Open in IMG/M |
Source Dataset Name | Biocrust microbial communities from Mojave Desert, California, United States - 25HNC |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 896 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 34.3778 | Long. (o) | -117.6098 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002328 | Metagenome | 570 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0334929_046963_86_364 | F002328 | N/A | VLCRIEDDSSLTPVSRHEDVLTGIAAAGYAVEVEDFDFAYALYSGDPGNGSTTRVASFREGRIGYRLWAVRTGRISPSVEDRYDHDVDELMA |
⦗Top⦘ |