NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334943_047158

Scaffold Ga0334943_047158


Overview

Basic Information
Taxon OID3300034137 Open in IMG/M
Scaffold IDGa0334943_047158 Open in IMG/M
Source Dataset NameBiocrust microbial communities from Mojave Desert, California, United States - 39SMC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)818
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.3778Long. (o)-117.6098Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015807Metagenome / Metatranscriptome252Y
F059436Metagenome / Metatranscriptome134N

Sequences

Protein IDFamilyRBSSequence
Ga0334943_047158_231_398F015807GGAMERLVRHDGESRDTDRPTWSHHRRRSGGQGARREAGSERLEENHRVVINGSDLER
Ga0334943_047158_395_817F059436GGAGMNRSAEDGEWSSPHYGGEGTWVPPRRTKVCAGDTVGKSASDPGRPGIVHREGMAGIVRHSQTKGRETGNAKPGLKPPVVGADISASEGPTEAVPGVGSGRGTQERGQSKRPRIAAGRAATPVGSKRPTGGGRPRAVWQRRR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.