Scaffold Ga0370498_000089

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0370498_000089

Scaffold Ga0370498_000089

Overview

Basic Information
Taxon OID	3300034155 Open in IMG/M
Scaffold ID	Ga0370498_000089 Open in IMG/M
Source Dataset Name	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	32237
Total Scaffold Genes	31 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	18 (58.06%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil → Peat Soil Microbial Communities From Wetland Fen In Alaska, United States

Source Dataset Sampling Location
Location Name	USA: Alaska
Coordinates	Lat. (^o)	64.9142	Long. (^o)	-147.8349	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001208	Metagenome / Metatranscriptome	747	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0370498_000089_26098_26337	F001208	N/A	MEEENLNLSWEIRVSEGRAGNDPEAPDWEVAELENGVVINNADIYDNLTFAEAQTICGMWTRKKEDAEGIEVAPEAAIQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.