NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334997_0004055

Scaffold Ga0334997_0004055


Overview

Basic Information
Taxon OID3300034280 Open in IMG/M
Scaffold IDGa0334997_0004055 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10429
Total Scaffold Genes26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)20 (76.92%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067543Metagenome / Metatranscriptome125Y
F081247Metagenome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0334997_0004055_7139_7417F081247AGGAGGMDNEEEIYGAGMPLLERLKLIAEWAPLIGRLQAVMDADTPYDQATAVVKTLQWAAGKSQTAIDDEALFHLEAVLKTPEGQAFFNWVVGKVTQ
Ga0334997_0004055_761_1093F067543GGAGMTPTVETSGYRLSPRVTLQPGDSFRVAGGPYYRLADGRRVPMAARGVFRLVEVRRHRCRVYLLGYGRDGWALIHVEGRRRSAVPGLVARPYRVRRAGRKDCRIDSGRVDA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.