NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335007_0062131

Scaffold Ga0335007_0062131


Overview

Basic Information
Taxon OID3300034283 Open in IMG/M
Scaffold IDGa0335007_0062131 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2853
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (62.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F102814Metagenome101N
F103142Metagenome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0335007_0062131_1253_1651F103142N/AMSERTSSKLGGIMSLDYKGFEWGNRITSDEDSVDRFLHEGLVAQAPSVGDLHSAAEWLATYGAENAEDAQGWANVVAFLILTAESKENRSALAKAKKKFAEANGIPVSQVRIKKEAEIIREGLALIPDKIDN
Ga0335007_0062131_1813_2334F102814AGGAMAGTKPRDGQRQRLYDAQRLAGFYDKGEVMTIKEAQKFVNQVLSHQKTKKLHKQYEFWASVYPSKIIVEAGSGNHATMRNRNWEVVRLIRLNKTGRNKFIILHEIAHHITWGRESHGAEFADVLLQFTTRYLGKPDADKLANAFNEKRVRVMTKSKKARVPRKREIVSARLVA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.