Scaffold Ga0348335_057924

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0348335_057924

Scaffold Ga0348335_057924

Overview

Basic Information
Taxon OID	3300034374 Open in IMG/M
Scaffold ID	Ga0348335_057924 Open in IMG/M
Source Dataset Name	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1441
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Fibrobacteres → unclassified Fibrobacterota → Fibrobacterota bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location Name	USA: Delaware Bay
Coordinates	Lat. (^o)	39.124826	Long. (^o)	-75.260873	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039399	Metagenome / Metatranscriptome	164	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0348335_057924_1048_1440	F039399	GGA	MKSYTYVKHKANSPWPNFAAALYVWRKLLFKRKARITITVGADISNASTGTNMWLKACGWKSGWHTKSNNETLIAYRIVGPCVEFCRYERRGERLSFEDEKKFARGLSFWKWKRSAKPTIEDQRARGIGRL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.