Scaffold Ga0348336_005313

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0348336_005313

Scaffold Ga0348336_005313

Overview

Basic Information
Taxon OID	3300034375 Open in IMG/M
Scaffold ID	Ga0348336_005313 Open in IMG/M
Source Dataset Name	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8983
Total Scaffold Genes	16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (12.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location Name	USA: Delaware Bay
Coordinates	Lat. (^o)	39.130153	Long. (^o)	-75.249887	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034909	Metagenome / Metatranscriptome	173	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0348336_005313_7858_8637	F034909	N/A	MASDAEDEGHIEHLEAKFLVDKQKRIENAMSWHPKQEKLIKSWGEKALGYRWIHHRCAVRHSVSHTNFSIVNIALTTLAGLGTLVASSEQENSQVLLYVFSFLNLSAAGIASVHKFLRCGEQYESNMQTSKLFSRLARDISLELSLEPEDRMNAVEYCHKVREDYDKIIDHAPEVPSDIIKEYKKMMDEEDPENKLARPEMANGKFKIYSSSERVNDESVQEHTTRWTNLLNKATNRWRSLPQAEQSARPTRASVASVV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.