Scaffold Ga0325419_005192

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0325419_005192

Scaffold Ga0325419_005192

Overview

Basic Information
Taxon OID	3300034389 Open in IMG/M
Scaffold ID	Ga0325419_005192 Open in IMG/M
Source Dataset Name	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	14384
Total Scaffold Genes	9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (55.56%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf → Understanding The Reciprocal Impacts Of Modified Plant Cell Wall And Associated Microbiome

Source Dataset Sampling Location
Location Name	USA: Georgia
Coordinates	Lat. (^o)	32.1348	Long. (^o)	-81.9657	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001358	Metagenome	715	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0325419_005192_10714_10899	F001358	AGG	VLGFSAKIYSKALVLTATLDPRVIFIILIIILNLHDSSLSEFDGNTRPNSFGCGSDCKIV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.