Scaffold Ga0374090_02291

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0374090_02291

Scaffold Ga0374090_02291

Overview

Basic Information
Taxon OID	3300034404 Open in IMG/M
Scaffold ID	Ga0374090_02291 Open in IMG/M
Source Dataset Name	Hot spring sediment microbial community from Evening Primrose, Yellowstone National Park, WY, USA - EP_sed
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Wisconsin, Madison
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4744
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (12.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Hyperthermophilic Archaeal Virus 1	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hot Spring Sediment → Evening Primrose Hot Spring Microbial Community

Source Dataset Sampling Location
Location Name	Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.69934	Long. (^o)	-110.76721	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000750	Metagenome / Metatranscriptome	908	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0374090_02291_3341_3646	F000750	GGA	MISIVITAVLFSYWLYKKLAKPRTFQFPIDIQTGDVIHGAFGSLLANLSLHVMYVDVMVGVLLYLTYQFTEFAVKQDTIYKDIATFMAGYFGTLVVGGIPL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.