Basic Information | |
---|---|
Taxon OID | 3300034404 Open in IMG/M |
Scaffold ID | Ga0374090_04807 Open in IMG/M |
Source Dataset Name | Hot spring sediment microbial community from Evening Primrose, Yellowstone National Park, WY, USA - EP_sed |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Wisconsin, Madison |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2292 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Caldivirga → unclassified Caldivirga → Caldivirga sp. MU80 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hot Spring Sediment → Evening Primrose Hot Spring Microbial Community |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.69934 | Long. (o) | -110.76721 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F099548 | Metagenome | 103 | Y |
F101501 | Metagenome | 102 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0374090_04807_1355_1690 | F099548 | N/A | MPWSVRRIVARLIVIAIKGAPGSCIHITPSLLGSTIGDGAVREALRLLRAMSLHGILDRVNGAYTLCSTDNPELWFMVKRLPIDEAVAWLLWLIEDASDGKPISAGPSYEL |
Ga0374090_04807_183_653 | F101501 | AGG | MRGMVPMERIVRENEEAIRSIVKSAFNGEYLGYTNDAIPFIIIKVKDGVIEEPITHQAFKPILDKSYKVLDGYEKARLLAYEVGSAFKVKPFYIQLLILDAIQLSKLLGIRDANTLVKTLLEHPLSQERAGMIGRPGVEWLVSRMIEVGLLNMPSP |
⦗Top⦘ |