NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0374090_04849

Scaffold Ga0374090_04849


Overview

Basic Information
Taxon OID3300034404 Open in IMG/M
Scaffold IDGa0374090_04849 Open in IMG/M
Source Dataset NameHot spring sediment microbial community from Evening Primrose, Yellowstone National Park, WY, USA - EP_sed
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Wisconsin, Madison
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2266
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hot Spring Sediment → Evening Primrose Hot Spring Microbial Community

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.69934Long. (o)-110.76721Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013613Metagenome / Metatranscriptome269Y
F077496Metagenome / Metatranscriptome117N

Sequences

Protein IDFamilyRBSSequence
Ga0374090_04849_1472_1978F013613GGAGGMPRPRKYPDGGVVISTYVPYELYEKVKELARSKGKNISEIAYELIKRGLEASGASAADPPDPPEDALHVALKGLEPLEREKVLQFMKGLEDAEAKLAKLGPNVRQARAGRPTLLDVVNQQEVVKLRGTVVDLKRTYERSIKRIVRDPATLNIIGERLLRLMKELGVPP
Ga0374090_04849_1953_2189F077496GGTGGLSAPQEEVGARLGRRKKWSGDAVIMTIYIPLDLKKELEARAAARRKSLSEYAVSLILKGLDAEKETEANKDAKAEEVP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.