Basic Information | |
---|---|
Taxon OID | 3300034479 Open in IMG/M |
Scaffold ID | Ga0314785_016524 Open in IMG/M |
Source Dataset Name | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R2 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 577 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From West Virginia University Organic Research Farm, Morgantown, Wv, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: West Virginia | |||||||
Coordinates | Lat. (o) | 39.6475 | Long. (o) | -79.9369 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F069733 | Metatranscriptome | 123 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0314785_016524_3_575 | F069733 | N/A | PCEQLEKPDLKGVGLLQISIQAFLRLLKFSIHFLLYLLINRLISRPCGSATRQKIAECRSFVRKIRTSLRISISRTAIANLHYSVSTYLDRSCEQSFRWKLFTKIDLSYSTPTYLSYPCEQLAQLRLFIQTCLAAKIHSLLRGLASAWLFAPCETLKPLCLKRTFSTSWDRTVSDIAIVDFSCTGIPINTC |
⦗Top⦘ |