NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0372972_007243

Scaffold Ga0372972_007243


Overview

Basic Information
Taxon OID3300034649 Open in IMG/M
Scaffold IDGa0372972_007243 Open in IMG/M
Source Dataset NameMetatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1400_MSt11 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2136
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5387Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008994Metagenome / Metatranscriptome324N
F068330Metagenome / Metatranscriptome124N
F076974Metagenome / Metatranscriptome117N

Sequences

Protein IDFamilyRBSSequence
Ga0372972_007243_1001_1258F076974AGGTGGMDNVKRRRGRPRKPATLEIDEFFAVLELLVENAKRHHMLESVLVTEGKLKVAFCVPLFGLTERLLSPKRDRLAESQSPTQLRMPL
Ga0372972_007243_14_952F068330N/AMQTLSQLAQPEVLIKLGIGLFLFALWTALYELGMRYNQGPGLSMIVATGMVVVLLAHGVMACQSSPQMRLAHGSAFALHMVIAIALSAFYVLSKAPELERQVVNLIGEFVMLGRTFYSALFGIAIAISLSAHIVSMASRNPVSGSQQAIASLATNIAIVLAIITSSIHLYQFGAEIAKLDLLSRLSATIMADISFIAIKSNIQHQIERRQKGGRYDYFDLIVWAVFGVVVSVYLILINSFVVRYTAGINDSGALLSLVVSLYGMSPTVLLAGLAALTVLTKVVDRETAPKSSARLDEQFSANGVTNRQGVKV
Ga0372972_007243_1719_2129F008994N/AMRVTRFAVDNNERALFPDYFIVDDNTRLALAMYSANINVQTIVDEGLALTPWLSTQWPGRTVSFNEWRDAFARNGHSFPQYHAQIGERVRLSELVNINRAFVELFMNGVDLTDPLNAQTHRELLTERNVDLVDFIK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.