NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0314793_060405

Scaffold Ga0314793_060405


Overview

Basic Information
Taxon OID3300034668 Open in IMG/M
Scaffold IDGa0314793_060405 Open in IMG/M
Source Dataset NameMetatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)716
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From West Virginia University Organic Research Farm, Morgantown, Wv, United States

Source Dataset Sampling Location
Location NameUSA: West Virginia
CoordinatesLat. (o)39.6475Long. (o)-79.9369Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003280Metagenome / Metatranscriptome496Y
F021280Metagenome / Metatranscriptome219Y

Sequences

Protein IDFamilyRBSSequence
Ga0314793_060405_352_711F003280N/AMDVPAKIEFLKSAIARQQMTLRLQSALAAMLLVLGLTVVILSFVNPGLILPETLKTGQTLGGIVVAASGFIPIFFSRHDMVVALRSLLHSYQHQQVGGLSRDAKLDHYFDQYFDKVLRG
Ga0314793_060405_3_350F021280GAGGMNVSTSLTPGDQLPVLLERIERREKSARIRAVLYALLPVALTVLLLGYASSSVRSAQKEVDALKAEASTFTTQIDTLKKNAESYKTQSQSLQGNADNYKTQVSELQAQLTEAQKSL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.