NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0370516_001089

Scaffold Ga0370516_001089


Overview

Basic Information
Taxon OID3300034696 Open in IMG/M
Scaffold IDGa0370516_001089 Open in IMG/M
Source Dataset NameHot spring water microbial communities from Yellowstone National Park, WY, United States - YNP_Buffalopool_103118
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13256
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Water → Hot Spring Sediment Microbial Communities From Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5324Long. (o)-110.7974Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009254Metagenome / Metatranscriptome320N
F013065Metagenome / Metatranscriptome274N
F020182Metagenome / Metatranscriptome225N

Sequences

Protein IDFamilyRBSSequence
Ga0370516_001089_13_270F020182N/AVSITEIVSAIREERLQDAARMLMERECVVTVYARRLLHVQCGKRVTLLAPWDSAAMLTQKLHILFGEPLSAEPCAGCPEHGGFQS
Ga0370516_001089_8577_8999F013065N/AMARRIARDATIAIQLGGVDDGSAITWSAATQIEGKCSEISIDYRSQNVNLAGLSDAYARMRSAGAAEYTIRIRAFIPSDSFDFYVSGNPPLHHRARVRVKPRSTLATEAEFTGVITKWSWSAQAGQEQIEEIEIVGPLDV
Ga0370516_001089_9034_9408F009254N/AVKLEIAEAHLRNFLARVIGAPIVSVPTELPAGSAVAGVLSLQSREAGKAIGGIRAVYQLELLASDAVPDKRRLILYALIANRILRTELASERDWLPMLDYQVFLEELNNERLRVRLEVEWNADE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.