NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0370516_020041

Scaffold Ga0370516_020041


Overview

Basic Information
Taxon OID3300034696 Open in IMG/M
Scaffold IDGa0370516_020041 Open in IMG/M
Source Dataset NameHot spring water microbial communities from Yellowstone National Park, WY, United States - YNP_Buffalopool_103118
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2575
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Water → Hot Spring Sediment Microbial Communities From Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5324Long. (o)-110.7974Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011084Metagenome / Metatranscriptome295Y
F036248Metagenome / Metatranscriptome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0370516_020041_1948_2427F011084GGAGGMMIDPQKVCILSSGYGDTIVAAEIERRGRKDYIPAENWRELEPAARDYLESRGVSVSETGKFDCPQHLVEQARFGFEVFWALSGLPLGDALAEWRRQVLGANDHSVFGIRHGVSPRQVLLLEKHNRIPRDAYTRRELERAYMLPQGFLRAVLEQRKRAR
Ga0370516_020041_254_787F036248AGGAGGMVMVNLFGIDEIREMMGTTKPIDGCLVVEVNLQPMQVAFTTEKPENDWKWFEYEYDPQDPACLPLFTQSPVYGVFLGPVRGGIPLAILSPAGGANFGVASFRGGEHRFNLIVHEAAHQAFRNRCVRLGDSILVHFPYDQQKVEWAKKHGGKFFSELKVWVFPAEMDEGLDNIVSDVV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.