Scaffold Ga0370516_067660

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0370516_067660

Scaffold Ga0370516_067660

Overview

Basic Information
Taxon OID	3300034696 Open in IMG/M
Scaffold ID	Ga0370516_067660 Open in IMG/M
Source Dataset Name	Hot spring water microbial communities from Yellowstone National Park, WY, United States - YNP_Buffalopool_103118
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1212
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Water → Hot Spring Sediment Microbial Communities From Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location Name	USA: Wyoming
Coordinates	Lat. (^o)	44.5324	Long. (^o)	-110.7974	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067776	Metagenome / Metatranscriptome	125	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0370516_067660_1_213	F067776	GAG	MGMALMSLGYARVDKAPTFQTDPYPFVENLGQLADREGRPLRDAYFSFEAPGMRGYVTRWGLTLYFYRLER

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.